DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and cela1.6

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:280 Identity:87/280 - (31%)
Similarity:138/280 - (49%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGG 69
            |:|...:||.|..||    |..|..:..:   |:.||..|....:|:|:.|...........|||
Zfish     4 ILLLSVLAALALAEP----RYLEEQIAQE---RVVGGEVARPNSWPWQISLQYLSGGSYYHTCGG 61

  Fly    70 SLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTV----------SSSDIIIHSGWNSANL 124
            :||...:|||||||.|..::..|.||         .|.:          :.|::.||..||..|:
Zfish    62 TLIKQNFVLTAAHCVDTSRTWRVVLG---------EHDIYKQEGREQYMTVSNVYIHPNWNRNNV 117

  Fly   125 R--NDISLIKIPATSSSSRISAVKLPSISNSYSTFV-GDVAVASGWGRTSDTSSGVATNLQYVDL 186
            .  .||:|:::  :|::|..:.|:|.::..|..... .:....:|||.|| |...::..|:...|
Zfish   118 AAGYDIALLRL--SSNASLNTYVQLGTLPPSGQVLPHNNACYITGWGLTS-TGGSLSAQLKQAYL 179

  Fly   187 TVITNTKCAQ--TYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGASAGC 247
            .|:....|::  .:|::|  .:|:..|...:.|.|.|||||||..:.|.:.:  |:|||.:|:||
Zfish   180 PVVDYNTCSRGDWWGSTV--KNTMVCAGGGSLSGCQGDSGGPLNCQVSGQYVVHGVTSFVSSSGC 242

  Fly   248 EKGY--PAAFTRVTSYLDWI 265
             ..|  |..||||::|:.||
Zfish   243 -NAYQKPTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 76/246 (31%)
Tryp_SPc 38..268 CDD:238113 77/247 (31%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.