DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and cela1.3

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021324991.1 Gene:cela1.3 / 445032 ZFINID:ZDB-GENE-040801-12 Length:283 Species:Danio rerio


Alignment Length:276 Identity:90/276 - (32%)
Similarity:142/276 - (51%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIILALAVAAS-AFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWC 67
            |.||.|:|.|: ...||      |.:..: ||.||:.||..|....:|:|:.|.....:.....|
Zfish    17 LRILLLSVLATLVLAEP------RYLEDI-DIEGRVVGGEVAKPNSWPWQISLQYLSGSSYYHTC 74

  Fly    68 GGSLIGSTWVLTAAHCTDGVQSVTVYLG-ATVRTSAEITHTVSSSDIIIHSGWNSANLRN--DIS 129
            |||||...||:|||||.|..::..|.|| ..:.........:|.|...||..|||.:|.:  ||:
Zfish    75 GGSLIRPGWVMTAAHCVDSPRTWRVVLGDHDIYNHEGREQYISVSRAHIHPNWNSNSLSSGYDIA 139

  Fly   130 LIKIPATSS-SSRISAVKLPS----ISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVI 189
            |:::.:.:| :|.:....||.    :.|:...::      |||||| .|...::..|:...|.|:
Zfish   140 LLELSSDASLNSYVQLAALPPSGQVLPNNNPCYI------SGWGRT-QTGGSLSAELKQAYLPVV 197

  Fly   190 TNTKCAQT--YGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGASAGCEKG 250
            .:..|:::  :|::|  .:|:........:.|:|||||||..:.|.:.:  |:|||.:||||...
Zfish   198 DHDTCSRSDWWGSTV--KNTMICGGDGTLAGCHGDSGGPLNCQVSGQYVVHGVTSFVSSAGCNTN 260

  Fly   251 -YPAAFTRVTSYLDWI 265
             .|..|:||::|:.||
Zfish   261 KRPTVFSRVSAYISWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 76/240 (32%)
Tryp_SPc 38..268 CDD:238113 77/241 (32%)
cela1.3XP_021324991.1 Tryp_SPc 45..279 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.