DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG11843

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:253 Identity:79/253 - (31%)
Similarity:109/253 - (43%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITGGSNAAVGQFPYQVGLSLKLSALSSA-W-CGGSLIGSTWVLTAAHCTDGVQSV--TVYLG--- 95
            |.||..|...:||:...|..:....|.| | |||.||...:|||||||.:..:..  .|.||   
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly    96 --ATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLPSISNSYSTFV 158
              :....:|...:.|:.  .|.|.|:......:||.|:|:   :.:......|.|:.........
  Fly   133 FDSLDEDAAPRDYMVAG--YIAHPGYEDPQFYHDIGLVKL---TEAVVFDLYKHPACLPFQDERS 192

  Fly   159 GDVAVASGWGRTSDTSSGVA----TNLQYVDLTVITNTKCAQTYGTSVVT-------DSTLCVAT 212
            .|..:|.|||     |:|:|    ..|..|.|....|..|.:.....|..       ::.|||.:
  Fly   193 SDSFIAVGWG-----STGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGS 252

  Fly   213 TDAKSTCNGDSGGPLVLKSSSEQ-----IGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            ..|:.||||||||||::......     :|:||.|.|.| ..|.|..:|||..||.||
  Fly   253 EMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/251 (31%)
Tryp_SPc 38..268 CDD:238113 79/253 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/253 (31%)
Tryp_SPc 68..309 CDD:214473 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.