DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG11841

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:120/275 - (43%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW-CGGSLIGSTWVLTAAHC--T 84
            |.||  |::.|       |:.|...:||:...|..:.:.....| |||:||.:..|||||||  :
  Fly    66 HGSR--PLIVD-------GTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFS 121

  Fly    85 DGVQSVTVYLGATVRTSAEITHTVSSSD----------IIIHSGWNSANLRNDISLIKIPATSSS 139
            :..:...|.||       |:.....:.|          :..|.|:.:..|.|||.::::   ...
  Fly   122 EHGEVNVVRLG-------ELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQL---DRE 176

  Fly   140 SRISAVKLPSI-----SNSYSTFVGDVAVASGWGR----TSDTSSGVATNLQ-YVD---LTVITN 191
            .:.:..|.|:.     ...:.:|     :|.|||:    ..::...:...|| |.|   .:|..|
  Fly   177 VKFNRYKHPACLPFDDGEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN 236

  Fly   192 TKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLV-----LKSSSEQIGLTSFGASAGCEKGY 251
            .:....|...    |.||:.:.|.|.|||||||||::     |......:|:||.|.:.. ....
  Fly   237 DELPNGYEPK----SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCS-TPDI 296

  Fly   252 PAAFTRVTSYLDWIK 266
            |:|:|||..:|:|||
  Fly   297 PSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 68/258 (26%)
Tryp_SPc 38..268 CDD:238113 71/260 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 70/265 (26%)
Tryp_SPc 72..310 CDD:214473 69/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.