DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG4815

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:236 Identity:51/236 - (21%)
Similarity:95/236 - (40%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGV-QSVTVYLGATVRTSAEITHTVSSSDIIIHS 117
            |:.::|.......|..:|:....:||||||.:.: :|....:|.   .|||.|            
  Fly    48 GVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGG---KSAEFT------------ 97

  Fly   118 GWNSANLRNDISLIKIPATSSSSRISAVKLPSISNS----YSTFVG------------DVAVASG 166
             |:..|. |...||::......:::..:...:::.:    .|.::|            |..:|:|
  Fly    98 -WHGNNF-NKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAG 160

  Fly   167 WGRTSDTSSGV-----ATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGP 226
            ||    ...||     ....:.:.:.:::...|.:..... :..:.:|....:.|:.|.||||||
  Fly   161 WG----FEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRK-MPPNIICAGAYNNKTLCFGDSGGP 220

  Fly   227 LVLKSSSEQIGLTSFGASAG-CEKGYPAAFTRVTSYLDWIK 266
            |:|  ..:..|:.::....| .||  |..:..|..|..:||
  Fly   221 LLL--GRQVCGINTWTFKCGNNEK--PDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 49/233 (21%)
Tryp_SPc 38..268 CDD:238113 51/236 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 50/235 (21%)
Trypsin 49..256 CDD:278516 48/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.