DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG10232

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:116/268 - (43%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGL---SLKLSALSSAWCGGSLIGSTWVLTAAHC--------TDGVQSV 90
            |:..|:.|...::|:...|   :.:||.:::. |.||||...:|||||||        ||.|.. 
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNN-CSGSLINKRYVLTAAHCVVKDKMVNTDLVLR- 318

  Fly    91 TVYLGA-TVRTSAEITHTVSSSDIIIHSG----------WNSANLRNDISLIKIPA----TSSSS 140
            .|.||. .:.|:.:...|.:.:...:..|          :|::...:||:|:::..    |....
  Fly   319 RVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEIL 383

  Fly   141 RISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDL----TVITNTKCAQTYGTS 201
            .|...|.|...:::...:      :|||.|.        |.:|..:    ||..|....|...:.
  Fly   384 PICVPKDPIPLHNHPLQI------AGWGYTK--------NREYSQVLLHNTVYENRYYCQDKISF 434

  Fly   202 VVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQ------IGLTSFGASAGCEKGYPAAFTRVTS 260
            ...:|.:|.:....:.:|.|||||||:|..:::.      .|:.|:| |..|....|..:|:..:
  Fly   435 FRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG-SENCGDRKPGVYTKTGA 498

  Fly   261 YLDWIKTN 268
            :..|||.|
  Fly   499 FFSWIKAN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 64/263 (24%)
Tryp_SPc 38..268 CDD:238113 66/265 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/262 (25%)
Tryp_SPc 260..503 CDD:214473 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.