DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and SPE

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:300 Identity:91/300 - (30%)
Similarity:137/300 - (45%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PEPELRHRSREMPVV--GDIGG-----RITGGSNAAVGQFPYQVGLSLK--LSALSSAWCGGSLI 72
            |.|..|...::..|:  .|:.|     ||.||:|..:.:||:.|.|..|  .|...:..|||:|:
  Fly   107 PTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALL 171

  Fly    73 GSTWVLTAAHC-------TDGVQSVTVYLGA-TVRTSAEITHTVSSSDI-------------IIH 116
            .|.:||||.||       ..|....:|.||. ..||..:.|..::...|             |||
  Fly   172 NSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIH 236

  Fly   117 SGW--NSANLRNDISLIKIP-ATSSSSRISAVKLPS---ISNSYSTFVGDVAVASGWGRTSDTSS 175
            ..:  ||.:.||||:|:::. ..|.:..:..:.||:   :.|::..:..|||   |||.|.    
  Fly   237 EMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVA---GWGLTE---- 294

  Fly   176 GVATNLQ--YVDLTVITN----TKCAQTYGTSVV--TDSTLCVATTDAKSTCNGDSGGPLVLKSS 232
                |:|  .:.|.:..|    |.|.:.|.:..|  .||.:|........||.|||||||::..|
  Fly   295 ----NMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPIS 355

  Fly   233 SEQ------IGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266
            :..      .|:||:|......||:|..:||..:::||||
  Fly   356 TGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 82/270 (30%)
Tryp_SPc 38..268 CDD:238113 83/271 (31%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 83/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.