DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG31199

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:246 Identity:48/246 - (19%)
Similarity:87/246 - (35%) Gaps:73/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSLIGSTWVLTAAHC---TDGV-QSVTVYLGA-----------------TVRTSAEITHTVSS 110
            |.|.|:....||..|||   .:|| ::.:|:||.                 .||.|.||    ..
  Fly    71 CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEI----KL 131

  Fly   111 SDIIIHSGWNSANLRNDISLIKIPATSS-SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTS 174
            ::|.||..::|..|:|.::::.:...:. ...:..:.:|..|....|.|....|.:|.....|..
  Fly   132 AEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFR 196

  Fly   175 SGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLT 239
            .....|       .::...|.....|.|.:.:|:|           |....|:.....:..:||.
  Fly   197 LKTWVN-------TLSRGFCQSKVKTLVTSSNTVC-----------GYHKQPVAYYLGAPLVGLQ 243

  Fly   240 SFGASAGCEKGY---------------------PAAFTRVTSYLDWIKTNT 269
                    :||:                     .::|..:.:|:|:|:.|:
  Fly   244 --------KKGHVTQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 46/240 (19%)
Tryp_SPc 38..268 CDD:238113 47/243 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 43/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.