DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG3505

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:117/270 - (43%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDIGGRITGGSNAAVGQFP------YQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHC-----TD 85
            |.:..:.:..::..:.:||      |..|...|:.|     |||.||...:|||||||     |.
  Fly   101 GKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHA-----CGGVLISDRYVLTAAHCVAQAATS 160

  Fly    86 GVQSVTVYLG---------------ATVRTSAEITHTVSSSDIIIHSGWNSANLR--NDISLIKI 133
            .:|...|.||               :.|...|.....::..:::.|..:|..:..  |||:|:::
  Fly   161 NLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRL 225

  Fly   134 PATSS-SSRISAVKLPS---ISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKC 194
            .:.:. :..:..:.||:   .::.....|.:||   ||    ..||.......||  |:.:..:|
  Fly   226 ASPAKLNDFVQPICLPNKQLRADELEDLVTEVA---GW----QASSSQRMRKGYV--TISSIEEC 281

  Fly   195 AQTYGTSV--VTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGASAGCEKGYPAAF 255
            .:.|.:..  :..|.||..|...:  |.|::||||:|..:...:  ||.|||........:|..:
  Fly   282 QRKYASQQLRIQASKLCGLTNSQE--CYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVY 344

  Fly   256 TRVTSYLDWI 265
            |||.||:|||
  Fly   345 TRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 68/263 (26%)
Tryp_SPc 38..268 CDD:238113 70/264 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 70/260 (27%)
Tryp_SPc 111..354 CDD:214473 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.