DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG31326

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:113/263 - (42%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW-CGGSLIGSTWVLTAAHCTD 85
            |.|:...|:       |..|.:...||.|:.|.:..:..:...|: |||:||.::.||:||||..
  Fly   265 RERASTTPL-------IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFR 322

  Fly    86 G------VQSVTVYLG---ATVRTSAEITHTVSSSDIIIHSGWNSANLRN-DISLIKI-PATSSS 139
            .      ...:.|.||   ..:.:..|..   ..|.:|||..:....... |::|::: .....:
  Fly   323 APGRDLPASRLAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQFKQFTEADLALVRLDEPVRYT 384

  Fly   140 SRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVT 204
            ..|..:.|.|.||......|..:..:||| ..:|.:|.....:..||.:::...||......:|.
  Fly   385 DYIVPICLWSTSNRMDLPQGLKSYVAGWG-PDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQ 448

  Fly   205 DSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGA----SAGCEKGYPAAFTRVTSYLD 263
            .|:||...|.| ..|..|.||||:|:.....:  |:.|.|.    ...||...|:.||.|..:::
  Fly   449 PSSLCAKKTGA-GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKHIE 512

  Fly   264 WIK 266
            |::
  Fly   513 WVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/245 (27%)
Tryp_SPc 38..268 CDD:238113 66/247 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/244 (27%)
Tryp_SPc 277..514 CDD:214473 64/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.