DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG9649

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:299 Identity:71/299 - (23%)
Similarity:115/299 - (38%) Gaps:72/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVAASAFPEPELRHRSREMPVVGDIGG-----------RITGGSNAAVGQFPYQVGLSLKLSALS 63
            |.|:..:|:           .:|.:.|           .|..|.....||.|:...|...:....
  Fly   229 AQASKFYPQ-----------TIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY 282

  Fly    64 SAWCGGSLIGSTWVLTAAHC-------TDGVQSVTVYLGATVRTSAEITH---TVSSSDIIIHSG 118
            :..|||:||.:..|::||||       ..|.::: |.||   |.|.::..   |:..:.::||..
  Fly   283 NFLCGGTLISARTVISAAHCFRFGSRNLPGERTI-VSLG---RNSLDLFSSGATLGVARLLIHEQ 343

  Fly   119 WNSANLRNDISLIKIPATSSSSRISAVK------------LPSISNSYSTFVGDVAVASGWGRTS 171
            :| .|:..|..|..:..::.......:|            |||...||         .:|||  .
  Fly   344 YN-PNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY---------VAGWG--E 396

  Fly   172 DTSSGVATNL-QYVDLTVITNTKC---AQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSS 232
            |......|.| :..|..:||..:|   ........:|..|:|.:...|...|:|||||.|:|:  
  Fly   397 DEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQ-- 459

  Fly   233 SEQIGLTSFGASAG------CEKGYPAAFTRVTSYLDWI 265
            .:.|.:.....|||      |....|..:|.|..:::|:
  Fly   460 EQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/259 (25%)
Tryp_SPc 38..268 CDD:238113 66/260 (25%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 65/258 (25%)
Tryp_SPc 259..497 CDD:214473 64/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.