DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG13318

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:271 Identity:81/271 - (29%)
Similarity:121/271 - (44%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTA 80
            ||.|.              |........|:.|.:|:|..|   |:.......||:||.:..||||
  Fly   155 FPPPP--------------GSTTAAPGQASFGAYPWQAAL---LTTADVYLGGGALITAQHVLTA 202

  Fly    81 AH--CTDGVQSVTVYLGA--TVRTSAEI-THTVSSSDIIIHSGWNSANLRNDISLIKIP---ATS 137
            ||  ...|:....|.||.  ...||..| ...|..|::.::..:|..||:||::::|:.   :.:
  Fly   203 AHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLT 267

  Fly   138 SSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQ-YVDLTVITNTKC-----AQ 196
            |.|.:..|.||:.|     |||.....:|||:....::|....:: .||:.:|.|..|     |.
  Fly   268 SKSTVGTVCLPTTS-----FVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQAT 327

  Fly   197 TYGTSVVTDST--LCVATTDAKSTCNGDSGGPLVLKSSS--EQIGLTSFGASAGC-EKGYPAAFT 256
            ..|:|.|...|  :|......|..|.||.|.|||..|:.  ..:||.::|  .|| :.|.|..:.
  Fly   328 RLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWG--IGCAQAGVPGVYV 390

  Fly   257 RVTSYLDWIKT 267
            .|.:||.||:|
  Fly   391 NVGTYLPWIQT 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 74/246 (30%)
Tryp_SPc 38..268 CDD:238113 77/249 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 77/243 (32%)
Tryp_SPc 169..399 CDD:214473 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.