DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and MP1

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:137/289 - (47%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EPELRHRSREMPVV----GDIGGRITGGSNAAVGQFPYQVGLS-LKLSALSSAWCGGSLIGSTWV 77
            :|..|..::.:|:.    .:.|.|:.||:.....:||:...:. .|...:....||||||...:|
  Fly   114 KPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYV 178

  Fly    78 LTAAHCTDGVQS----VTVYLG---------ATVRTSAE-------ITHTVSSSDIIIHSGW--N 120
            ||||||...:.|    ..|.||         .||..:..       :.:.|  .:.|.|..:  |
  Fly   179 LTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPV--EERIPHPQYPGN 241

  Fly   121 SANLRNDISLIKI-PATSSSSRISAVKLPSISNSYST-FVGDVAVASGWGRTSDTSSGVATNLQY 183
            |.:..|||:|::: .....|..|..|.||::::.::. |:|...|.:||||   |.:...:|::.
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGR---TETNFTSNIKL 303

  Fly   184 -VDLTVITNTKCAQTYGTS--VVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQ------IGLT 239
             .:|..:..::|.|.|.|.  .||...:|....:...:|.|||||||:|:..|..      .|:.
  Fly   304 KAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368

  Fly   240 SFGASAGCEKGYPAAFTRVTSYLDWIKTN 268
            |:|.:....||:|..:|||.:||:||:.|
  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/261 (30%)
Tryp_SPc 38..268 CDD:238113 78/263 (30%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 77/261 (30%)
Tryp_SPc 138..397 CDD:238113 78/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.