DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG18223

DIOPT Version :10

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:73 Identity:17/73 - (23%)
Similarity:26/73 - (35%) Gaps:17/73 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 FNSKKVSPKVPSGSYNIAQVTYELNLLGTRGPRRMNCIMHSIPSLALEPGGTVPSQPEFLQRSLD 288
            |.:|:..|    .:.|.|::|.:|.|             ||:.........|..:..|.|...||
  Fly   124 FANKQDLP----NAMNAAEITDKLGL-------------HSLRQRHWYIQSTCATSGEGLYEGLD 171

  Fly   289 ESFRSIGS 296
            ....:|.|
  Fly   172 WLSNNIAS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 9/40 (23%)
CG18223NP_649077.1 Tryp_SPc 60..280 CDD:214473 17/73 (23%)

Return to query results.
Submit another query.