DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG11529

DIOPT Version :10

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:72 Identity:16/72 - (22%)
Similarity:24/72 - (33%) Gaps:22/72 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GKFLLSAKRSRRATYTEYVISMDADNISRSSSTYIGKLKSNFLGTKFIVYDTAPAYNSSQILSPP 218
            |..||....|..||..:.:...|...:.|..|              |::.|.:        |:..
  Fly     3 GGLLLDVVISECATVFKLLTGKDKPLLIRRDS--------------FLILDLS--------LNIV 45

  Fly   219 NRSRSFN 225
            |..|:||
  Fly    46 NSIRTFN 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 16/72 (22%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 6/24 (25%)

Return to query results.
Submit another query.