DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG33460

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:219 Identity:47/219 - (21%)
Similarity:86/219 - (39%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDI 128
            |.:|.|:||...::||||.|. ...:|.|.||...|...|:.........:::..:|:.:|.|:|
  Fly    54 SIFCAGTLITDVFILTAASCI-RPNAVKVRLGEFGRYPNELPEDHLVHYFLMYRLFNNESLANNI 117

  Fly   129 SLIKIPATSSSSRIS--------AVKLPSISNSYST--FVGDVAVASGWGRTSDTSSGVATNLQY 183
            .|:|:     :.|:.        .:.|...:...||  |:|     :.|  ..|::..:...|: 
  Fly   118 GLLKL-----TKRVQITDYIMPVCIVLNPQNQQLSTMRFIG-----NAW--MEDSNVSLTKELR- 169

  Fly   184 VDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKS------SSEQIGLTSFG 242
               .::..:|........:.|.  .|........:|:|.:|..|:..|      ...|.|:.:..
  Fly   170 ---PIVIQSKPKMCTNLDLYTQ--FCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVN 229

  Fly   243 ASAGCEKGYPAAFTRVTSYLDWIK 266
             ...||:.  ..:|.|..:..||:
  Fly   230 -DMDCEES--QGYTDVLKFYWWIQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 45/216 (21%)
Tryp_SPc 38..268 CDD:238113 47/219 (21%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 47/219 (21%)
Tryp_SPc 44..249 CDD:214473 45/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.