DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG10469

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:251 Identity:87/251 - (34%)
Similarity:131/251 - (52%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSA--WCGGSLIGSTWVLTAAHCTDGVQS----VTVYLG 95
            ||..|:.|...|.||||||..........  .|||:::.:.|::|||||....:|    |.:::|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    96 ATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSR-ISAVKLPSISNSYSTFVG 159
             .|::..:....|:.|..|:|..::...:.|||:|||:|...:.:: |...||||...:|:   |
  Fly    88 -KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYT---G 148

  Fly   160 DVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTY-----GTS--VVTDSTLCVATTDAKS 217
            ..|:.||||.|  |....:..|||:...:|:|.:|.:.:     |.|  ||.:..:|:   |:|.
  Fly   149 RKAIISGWGLT--TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICI---DSKK 208

  Fly   218 --TCNGDSGGPLVLKSSSEQ-IGLTSFGASAGCEKGYPAAFTRVTSYLDWIKTNTG 270
              .|.||||||:||...|.. :|:.|.|....|:...|...|||:|||.|||..:|
  Fly   209 GLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 83/244 (34%)
Tryp_SPc 38..268 CDD:238113 85/246 (35%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 83/244 (34%)
Tryp_SPc 24..260 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470991
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.