DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Jon65Aii

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:275 Identity:115/275 - (41%)
Similarity:153/275 - (55%) Gaps:22/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALA----VAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSA 61
            ||.|.:|..:    |||...|.|     .::||....|.||||.|..|..|:.||.|.|......
  Fly     1 MKVLGVLLFSAFALVAALERPVP-----VKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGN 60

  Fly    62 LSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRN 126
            ....:||||:||..|||||||||.|...||:..||..|...:.||            :::.||.|
  Fly    61 GGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTH------------YDTGNLHN 113

  Fly   127 DISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITN 191
            ||:||:.|.....|.::.|:||...:.|:.|.|..|:.||||.:|| |||:...|..||:.:..|
  Fly   114 DIALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSD-SSGMTDYLNCVDIQISDN 177

  Fly   192 TKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFT 256
            :.|...||:..:|.:.||.||.:.|.:|:|||||||||...:.|:|:.|||::|||....|...|
  Fly   178 SVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLT 242

  Fly   257 RVTSYLDWIKTNTGI 271
            |||.|||||:.:|||
  Fly   243 RVTGYLDWIRDHTGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 97/227 (43%)
Tryp_SPc 38..268 CDD:238113 98/229 (43%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 97/227 (43%)
Tryp_SPc 37..254 CDD:238113 98/229 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470882
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.