DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG13527

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:224 Identity:64/224 - (28%)
Similarity:99/224 - (44%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITH------------TVSS----SDII 114
            :|||.|:.:.||:|||||..| ||..:|....:...|...|            .|||    .:..
  Fly    61 YCGGGLLSNQWVITAAHCVMG-QSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFT 124

  Fly   115 IHSGWNSANLRNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVAT 179
            :|:.:|.|.::..   .|:|  |:..||..:.||..:..    :|......||||.. ....:|.
  Fly   125 MHNTFNMALMKLQ---EKMP--SNDPRIGFLHLPKEAPK----IGIRHTVLGWGRMY-FGGPLAV 179

  Fly   180 NLQYVDLTVITNTKCA---QTYGTSVVTDSTLCVA----TTDAKSTCNGDSGGPLVLKSSSEQIG 237
            ::..||:.::.|..|.   :.||     |..:|..    |.||: .|:||.|.||:  |....:|
  Fly   180 HIYQVDVVLMDNAVCKTYFRHYG-----DGMMCAGNNNWTIDAE-PCSGDIGSPLL--SGKVVVG 236

  Fly   238 LTSFGASAGCEKGYPAAFTRVTSYLDWIK 266
            :.::....|| ...|:.:|.|.|.|.||:
  Fly   237 IVAYPIGCGC-TNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 62/221 (28%)
Tryp_SPc 38..268 CDD:238113 64/224 (29%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 64/224 (29%)
Tryp_SPc 43..263 CDD:214473 62/221 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.