DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG10764

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:249 Identity:74/249 - (29%)
Similarity:120/249 - (48%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS 101
            :|:||.:||.   |..:.::...:: |...|||::|...:||:||||......:.|.|||.....
  Fly    37 KISGGDDAAE---PNSIWMAAIFNS-SDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINE 97

  Fly   102 AEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVKL--------PSISNS---YS 155
            ....|||  .::.:|..:.::..||||.|:::    |.|.:..|::        |::..|   ..
  Fly    98 PAAVHTV--INVFVHHDFIASEYRNDIGLLQL----SESIVYTVRVQPICIFLDPALKGSVEKLK 156

  Fly   156 TFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCN 220
            ||     .|.|||   :.:..::..||.:.|..:...:|.:....: :....:|..|.:. .||.
  Fly   157 TF-----RALGWG---NRNGKLSIMLQTIYLLHLKRNECKRKLNFN-LNSRQICAGTKNG-DTCR 211

  Fly   221 GDSGGPL---VL----KSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIKT 267
            |||||||   :|    ||...|:|:.||| ...| :|. ..:|.||||:|||.:
  Fly   212 GDSGGPLSTNILFPSNKSYEVQLGIVSFG-DPEC-RGV-GVYTDVTSYVDWISS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 72/245 (29%)
Tryp_SPc 38..268 CDD:238113 74/248 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/245 (29%)
Tryp_SPc 38..263 CDD:238113 74/248 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.