DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Prss48

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:284 Identity:87/284 - (30%)
Similarity:132/284 - (46%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65
            :|.|::|.|.....:|.:.:........||   ..|||.||.:||:|::|:||  ||:.....| 
Mouse     6 LKVLLLLFLGAFQGSFTKKKNLQSVCGRPV---HTGRIVGGQDAALGRWPWQV--SLRFDYTHS- 64

  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQSV------TVYLGATVRTSAEITHTVSSSDIIIHSGWNSANL 124
             ||||||...||||||||   ::..      :|:||:..|..:........|.|.|..  ...:.
Mouse    65 -CGGSLISDHWVLTAAHC---IKKTWYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPD--KHRHT 123

  Fly   125 RNDISLIKIPA-TSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTV 188
            ..||:|:|:.: .:.||.|..:.||:||...:  |......:|||:..:  ....:.||.:::.|
Mouse   124 EADIALLKLSSRVTFSSVILPICLPNISKQLT--VPASCWVTGWGQNQE--GHYPSTLQELEVPV 184

  Fly   189 ITNTKCAQTYG---------TSVVTDSTLCVATTDA-KSTCNGDSGGPLV--LKSSSEQIGLTSF 241
            |::..|.|.|.         ..|:.:...|.....: |.:|.|||||||.  :......:|:.|:
Mouse   185 ISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSW 249

  Fly   242 GASAGCEKGYPAAFTRVTSYLDWI 265
            |..  |.|..|..:|.||.|..||
Mouse   250 GLE--CGKDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/246 (31%)
Tryp_SPc 38..268 CDD:238113 78/247 (32%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 77/246 (31%)
Tryp_SPc 40..274 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.