DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG12133

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:267 Identity:79/267 - (29%)
Similarity:119/267 - (44%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ITGGSNAAVGQFPYQVGLSLKLSALS---SAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVR 99
            |.||..|...|||:.|.|..:.....   |..|.||||.|.:|||||||.    :|..:..|.||
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL----NVNDFYVARVR 122

  Fly   100 TSAEIT-------------------HTVSSSDI-IIHSGWNSANLR--NDISLIKIPA-TSSSSR 141
            .....|                   |.....|: :.|..:.:.|.|  |||:|:::.: ...:.:
  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQ 187

  Fly   142 ISAVKL-PSISNSYSTFVGDVAVASGWGRTSDTSSGV---ATNLQYVDLTVITNTKCAQTYGTSV 202
            |..:.: |.|..|.|:|.......:|||     .||:   :|.|:...::.::..:|...|.|.:
  Fly   188 IRPICIWPGIELSTSSFKNFPFQIAGWG-----DSGLQQKSTVLRQGTISGMSPDECLNRYPTLL 247

  Fly   203 V-TDSTLCVATTDAKSTCNGDSGGPLV--LKSSSEQI----GLTSFGASAGCEKGY-PAAFTRVT 259
            | .|..:|....|...|..||||.||:  :...::|.    |:||:|.... ..|| ||.:|:.:
  Fly   248 VDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPS-SYGYGPAVYTKTS 311

  Fly   260 SYLDWIK 266
            ||.:|||
  Fly   312 SYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 76/264 (29%)
Tryp_SPc 38..268 CDD:238113 79/267 (30%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 79/267 (30%)
Tryp_SPc 62..317 CDD:214473 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.