DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and scaf

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:247 Identity:51/247 - (20%)
Similarity:95/247 - (38%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTV-------YLGAT--- 97
            :|...:.|:| .:.|:.|: .:..|||::||..:||::|.|.:|:....:       .||:|   
  Fly   428 DANFAEIPWQ-AMILRESS-KTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEP 490

  Fly    98 -------VRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIP-ATSSSSRISAVKL----PSI 150
                   |:|            :.:|..::.:...:|:::|::. ....:|.|..:.:    |..
  Fly   491 LPFQLTGVKT------------VDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKD 543

  Fly   151 SNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDA 215
            |....|        ||||:.:.:.......:...|......::|:       ...|::|.||  .
  Fly   544 SEQCFT--------SGWGKQALSIHEEGALMHVTDTLPQARSECS-------ADSSSVCSAT--K 591

  Fly   216 KSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIKT 267
            ..:|..|.|..|...|.|.......|.....|.:|....|.:..  :.||.|
  Fly   592 FDSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPD--IKWINT 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 48/243 (20%)
Tryp_SPc 38..268 CDD:238113 51/247 (21%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 44/218 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.