DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG17572

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:286 Identity:71/286 - (24%)
Similarity:126/286 - (44%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SREMPVV---------GDIGGR--ITGGSNAAVGQFPYQVGLSLK-LSALSSAW-CGGSLIGSTW 76
            |.|:|.|         ..:.|:  :.|.....:|.:|:...:..| ::..:.|: |.|::|....
  Fly   105 SEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRV 169

  Fly    77 VLTAAHC----TDGVQSVTVYLGATVRTSAE-------------ITHTVSSSDIIIHSGWNSANL 124
            :||||||    .||.:..:|.:| ...||::             :.|.:  |.:|:|..:.....
  Fly   170 ILTAAHCALAKADGHRLSSVRVG-EYDTSSDPDCANTGFCAPRSVNHAI--SHVIVHPDYKQGQY 231

  Fly   125 RNDISL--IKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLT 187
            .:||:|  :|.|...|   ::...:.......:..||..|..:|||:.| |||.....:.::|:.
  Fly   232 HHDIALLVLKTPLNYS---VATQPICLQKTRANLVVGKRATIAGWGKMS-TSSVRQPEMSHLDVP 292

  Fly   188 VITNTKCAQTYGTSVVTDST-------LCVATTDAKSTCNGDSGGPLVLKSSS--EQIGLTSFGA 243
            :.:...|.:.||::...:|.       :| |..:.|..|.|..|.||.::.:.  .|||:.|||:
  Fly   293 LTSWDLCLRNYGSTGALESPNSIEGQWMC-AGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGS 356

  Fly   244 SAGCEKGYPAAFTRVTSYLDWIKTNT 269
            ........|:.:|.|..:.:||..||
  Fly   357 DNCGGLRIPSVYTSVAHFSEWIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 62/259 (24%)
Tryp_SPc 38..268 CDD:238113 64/259 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 63/250 (25%)
Tryp_SPc 138..378 CDD:214473 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.