DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG4650

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:118/272 - (43%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MPVVGD---IGGR---ITGGSNAAVGQFPYQVGLSLKLSALSSAW------------CGGSLIGS 74
            :||.|.   :.||   :|.|..|               :.:||.|            |||::|..
  Fly    15 LPVPGSSQYLDGRCGLLTNGKIA---------------NNISSPWMAYLHTSELLYVCGGTVITE 64

  Fly    75 TWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSS----SDIIIHSGWNSANLRNDISLIKIPA 135
            ..||||||||...:.:...:|..:.|. :...|:.|    |...|||.:|:....|||:::.: |
  Fly    65 KLVLTAAHCTRASEQLVARIGEFIGTD-DANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGL-A 127

  Fly   136 T----SSSSRISAVKLPSISNSYSTFVGDVAVASG--WGRTSDTSSGVATNLQYVDLTVITNTKC 194
            |    |.:.|...:...:|...|   :.::.|.||  ||..:|.:...|  .:..|:.......|
  Fly   128 TDIVFSKTIRPICIVWWTIWRKY---IDNIQVLSGAQWGLPNDRNESDA--FRITDIRRQPANMC 187

  Fly   195 AQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL--VLKSSSEQ----IGLTSFGASAGCEKGYPA 253
            :...||:::: |..|...:|:| .||.|...||  ::...:.|    ||:.:  .:..|::.  :
  Fly   188 STLNGTAILS-SQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCKRA--S 246

  Fly   254 AFTRVTSYLDWI 265
            .:|.|.|:.|:|
  Fly   247 VYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/258 (25%)
Tryp_SPc 38..268 CDD:238113 65/256 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 63/252 (25%)
Tryp_SPc 33..258 CDD:304450 63/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.