DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG9377

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:93/249 - (37%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDG--VQSVTVYLG---ATVRTSAE 103
            |..|:||:.|.    :....:..|.|:||....|:|.|||...  ::.|.:..|   |.|....:
  Fly   107 AKFGEFPWLVA----VYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQ 167

  Fly   104 ITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSS---SSRISAVKL--PSISNSYSTFVGDVAV 163
            .....|..:.::|..:....|.::|:::.:.....   :..:..:.|  |.|..:||.     ..
  Fly   168 PHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ-----CY 227

  Fly   164 ASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVV------TDSTLCVATTDAKSTCNGD 222
            .|||.| ||.........::. |.|:...:|......|::      .||.||.........| ||
  Fly   228 VSGWQR-SDFGRAAILPKRWT-LYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GD 289

  Fly   223 ---SGGPLVLKSSSEQ-----IGLTSFGASAGCEKGYP---AAFTRVTSYLDWI 265
               :..||:...|...     .||.:  .:|.|:.  |   ..:|.|..|..||
  Fly   290 VDMTAVPLMCPLSGHDDRFHLAGLLT--RTARCDG--PQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 55/247 (22%)
Tryp_SPc 38..268 CDD:238113 57/249 (23%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 57/249 (23%)
Tryp_SPc 105..339 CDD:214473 55/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.