DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and prss60.3

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:261 Identity:95/261 - (36%)
Similarity:136/261 - (52%) Gaps:27/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EMPVVGD--IGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQS 89
            ::.|.|.  :..||.||.||:.|.:|:||  ||........:||||||.|.||||||||..||..
Zfish    23 QLNVCGQAPLNTRIVGGVNASPGSWPWQV--SLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSE 85

  Fly    90 VT--VYLGATVRTSAEITHT---VSSSDIIIHSGWNSANLRNDISLIKI-PATSSSSRISAVKLP 148
            .|  ||||...:....|..|   |:.|  .:||.:||....|||:|::: .|.:.::.|..|.|.
Zfish    86 TTLVVYLGRRTQQGINIYETSRNVAKS--FVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLA 148

  Fly   149 SISNSYSTFVGDVAVASGWGRTSDTSSGVATN----LQYVDLTVITNTKCAQTYGTSVVTDSTLC 209
            :.::.||  .|..:..:|||   |..:||...    ||...:.|:.|.:|....|:..||::.:|
Zfish   149 AQNSVYS--AGTSSWITGWG---DIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMIC 208

  Fly   210 VATTD-AKSTCNGDSGGPLVLKSSS--EQIGLTSFGASAGC-EKGYPAAFTRVTSYLDWIKTNTG 270
            ...|. .|.||.||||||:|.:..:  .|.|:||:|  .|| :...|..:|||:.|..||.:...
Zfish   209 AGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWISSKIS 271

  Fly   271 I 271
            :
Zfish   272 L 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 91/241 (38%)
Tryp_SPc 38..268 CDD:238113 92/243 (38%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 92/243 (38%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.