DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and psh

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:295 Identity:87/295 - (29%)
Similarity:123/295 - (41%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGS 74
            ||||........:.||....|:     .|.||.....|.:|:...:.. ::..:...||||||.|
  Fly   121 AVAACKKIRERKQQRSGNQLVI-----HIVGGYPVDPGVYPHMAAIGY-ITFGTDFRCGGSLIAS 179

  Fly    75 TWVLTAAHC--TDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHS--------GWNSANLRNDIS 129
            .:|||||||  ||......|.|||....:.:  |  |..||:|.|        |    |..|||:
  Fly   180 RFVLTAAHCVNTDANTPAFVRLGAVNIENPD--H--SYQDIVIRSVKIHPQYVG----NKYNDIA 236

  Fly   130 LIKI-----------PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQY 183
            ::::           ||...:   .|...||.|..:         .:|||..:.|:...:..|..
  Fly   237 ILELERDVVETDNIRPACLHT---DATDPPSNSKFF---------VAGWGVLNVTTRARSKILLR 289

  Fly   184 VDLTVITNTKCAQTYGTSV---------VTDSTLCVATTDAK---STCNGDSGGPLVLKSSSEQ- 235
            ..|.::...:|..:|....         |.||.||  ..|.|   ..|.|||||||:.:.:.|. 
  Fly   290 AGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC--AIDQKLIADACKGDSGGPLIHELNVEDG 352

  Fly   236 ----IGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266
                :|:.|.|  .||....|..:|||:||||:|:
  Fly   353 MYTIMGVISSG--FGCATVTPGLYTRVSSYLDFIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 79/265 (30%)
Tryp_SPc 38..268 CDD:238113 80/267 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 79/265 (30%)
Tryp_SPc 144..387 CDD:238113 80/267 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437037
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.