DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Hayan

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:263 Identity:72/263 - (27%)
Similarity:118/263 - (44%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GGR-----ITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVT--V 92
            ||:     |..|.....|.:|:...::......::..||||||.|.:|||||||.:...|..  |
  Fly   377 GGKPLTVHILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFV 441

  Fly    93 YLGA-TVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLPSI------ 150
            .||| .:.........::..|:.||..::.::...||:::::   :..::.|.|..|:.      
  Fly   442 RLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQL---AEDAKESDVIRPACLYTDRS 503

  Fly   151 --SNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSV---------VT 204
              ..:|..||      :|||..:.|:..|:..|....|.::...:|..::....         |.
  Fly   504 DPPANYKYFV------AGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVI 562

  Fly   205 DSTLCVA-TTDAKSTCNGDSGGPLVLK-----SSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLD 263
            .|.||.| ....|..|.|||||||:|:     .:...:|:.|.|  .||....|..:|||:|:||
  Fly   563 ASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLD 625

  Fly   264 WIK 266
            :|:
  Fly   626 YIE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 69/258 (27%)
Tryp_SPc 38..268 CDD:238113 70/255 (27%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 69/253 (27%)
Tryp_SPc 385..630 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437038
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.