DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG31220

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:300 Identity:89/300 - (29%)
Similarity:135/300 - (45%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PEPELRHRSREMPVVGDIG-----GRITGGSNAAVGQFPYQVGLSLKLSALSSAW---------C 67
            |:|     :..:|...|.|     .|:.||:...:.::|:   |::.|....||:         |
  Fly    83 PKP-----ANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPW---LAMLLYRNRSAFNPDRELVPSC 139

  Fly    68 GGSLIGSTWVLTAAHC-TDGV-QSVTVYLGA--------TVRTSAEI----TH-TVSSSDIIIHS 117
            |||||.:.:||||||| ||.| |...|.||.        .:...|.|    || .:....|..|:
  Fly   140 GGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHN 204

  Fly   118 GWNSAN--LRNDISLIKIPA----TSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTS--DTS 174
            .::.||  .||||:|:::..    |.:...|..:..|.....:..:|      :|||:|.  ||.
  Fly   205 DYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYV------AGWGKTGMFDTG 263

  Fly   175 SGVATNLQYVDLTVITNTKCAQTY-----GTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKS--S 232
            |.|   |::..:.|....:|::.|     |...    .:|....|.:.||:||||.||:..|  |
  Fly   264 SKV---LKHAAVKVRKPEECSEKYAHRHFGPRF----QICAGGLDNRGTCDGDSGSPLMGTSGRS 321

  Fly   233 SEQI----GLTSFGASAGCEKGYPAAFTRVTSYLDWIKTN 268
            .|.|    |:||:|...| ..|:|:.|||...:..||:.:
  Fly   322 YETITFLAGITSYGGPCG-TIGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 82/270 (30%)
Tryp_SPc 38..268 CDD:238113 83/272 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 82/270 (30%)
Tryp_SPc 104..360 CDD:238113 83/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.