DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG8952

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:278 Identity:105/278 - (37%)
Similarity:153/278 - (55%) Gaps:19/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65
            :..:::.|::|....| :|     :...|:  .|..||..||:|.:||||:||  .||..|....
  Fly     9 LMLVLLAAISVVGQPF-DP-----ANSSPI--KIDNRIVSGSDAKLGQFPWQV--ILKRDAWDDL 63

  Fly    66 WCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISL 130
            .||||:|..||||||||||:|:.|:.:..|.....:|...: ::|::||||..:|. .|.||:||
  Fly    64 LCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNANALN-MTSNNIIIHPDYND-KLNNDVSL 126

  Fly   131 IKIP-ATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKC 194
            |::| ..:.|:.|.|::|.........:||.||..:|:|.|.|.....:..|.|..:.:|.|..|
  Fly   127 IQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADC 191

  Fly   195 AQTYGTSVVTDSTLCVATTDAK--STCNGDSGGPLVLKSSS----EQIGLTSFGASAGCEKGYPA 253
            ...||..||.|||:|....|..  |||.|||||||:|.:.:    :|||:.||.|...|....|:
  Fly   192 VAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPS 256

  Fly   254 AFTRVTSYLDWIKTNTGI 271
            .:.||:|:|.:|...|||
  Fly   257 GYARVSSFLGFIADKTGI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 95/234 (41%)
Tryp_SPc 38..268 CDD:238113 95/236 (40%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 95/234 (41%)
Tryp_SPc 38..271 CDD:238113 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471045
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.