DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and sphinx1

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:126/280 - (45%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIILALAVAASAFPEPELRHRSREMPVVGD---IGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65
            |::|:|.|:                  ||:   :..||.||..|......|.||:....|..||.
  Fly     7 LLVLSLTVS------------------VGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSL 53

  Fly    66 WCG-GSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDII-IHSGWNSANLR--- 125
            ..| |::|.:.|:||       |::|..|....|..::.  .:....||| |:    ..|.|   
  Fly    54 NYGAGTIISNQWILT-------VKTVLKYSYIEVHLASR--RSYRGFDIIRIY----KENFRFHY 105

  Fly   126 -ND--ISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLT 187
             ||  |:|:|.|......|:..|::|:....:..:||::.:..|:| |....:.:...::.:::.
  Fly   106 DNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWMRCIEVE 169

  Fly   188 VITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQ-IGLTSFGASAGCEKGY 251
            |:.||:||:.|  :.:....:|.:....|..|.||.||.:|....:.. ||:. :.....|..||
  Fly   170 VMNNTECAKYY--TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGY 231

  Fly   252 PAAFTRVTSYLDWIKTNTGI 271
            |:...||:.::.|||..:|:
  Fly   232 PSVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 63/236 (27%)
Tryp_SPc 38..268 CDD:238113 65/238 (27%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 63/236 (27%)
Tryp_SPc 26..248 CDD:304450 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.