DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG11664

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:192 Identity:52/192 - (27%)
Similarity:83/192 - (43%) Gaps:12/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GSLIGSTWVLTAAHC-TDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIK 132
            |||..:.:|||.||| ....:...:.:.|..|..|........:.::.|..::...|||||::::
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLR 113

  Fly   133 IPAT-SSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQ 196
            :.|. |.|..|:.:.|.|...:...........:||....     :|..|:.:.:.|.....|.|
  Fly   114 VKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMH-----IAQPLKSMSVQVEPEKNCRQ 173

  Fly   197 TYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRV 258
            .:  ..::...:|.:.|..:..|.||||.||:  |..|..||.......| :|.|||.||.|
  Fly   174 WF--PQISGGVICASATMGEGLCYGDSGDPLI--SGGEVCGLAIAFRKCG-DKRYPALFTDV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 52/192 (27%)
Tryp_SPc 38..268 CDD:238113 52/192 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 52/192 (27%)
Tryp_SPc 38..237 CDD:214473 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.