DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Prss30

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:270 Identity:86/270 - (31%)
Similarity:129/270 - (47%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDI----------GGRITGGSNAAVGQFPYQVGLSLKLSALSSAW-------CGGSLIGSTWVLT 79
            |||          .|:|.||.:|..||:|:||.|          |       ||||||...||||
Mouse    58 GDILPSVCGHSRDAGKIVGGQDALEGQWPWQVSL----------WITEDGHICGGSLIHEVWVLT 112

  Fly    80 AAHCTDGVQSVTVYL----GATVRTSAEITHTVSSSDIIIHSG--WNSANLRNDISLIKIPATSS 138
            ||||.....:.:.|.    |.|:......:..|:..:|.:|..  |..|: ..||:|:::.....
Mouse   113 AAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADAS-SGDIALVQLDTPLR 176

  Fly   139 SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTY----- 198
            .|:.:.|.||:.....:.  |.|...:|||.|.:..  :|:.||.:.:.::.:..|.:.|     
Mouse   177 PSQFTPVCLPAAQTPLTP--GTVCWVTGWGATQERD--MASVLQELAVPLLDSEDCEKMYHTQGS 237

  Fly   199 ---GTSVVTDSTLCVATTDA-KSTCNGDSGGPLV--LKSSSEQIGLTSFGASAGCEKGY-PAAFT 256
               |..::....||....:. |.:|.||||||||  :.||..|:|:||:|  .||.:.| |..:|
Mouse   238 SLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWG--IGCARPYRPGVYT 300

  Fly   257 RVTSYLDWIK 266
            ||.:|:|||:
Mouse   301 RVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 80/252 (32%)
Tryp_SPc 38..268 CDD:238113 82/254 (32%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.