DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Mcpt2

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:285 Identity:85/285 - (29%)
Similarity:122/285 - (42%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCG 68
            |.::||.:.:.|..|                  .|.||..:.....||...|.:.........||
  Rat     5 LFLMALLLPSGAGAE------------------EIIGGVESIPHSRPYMAHLDIVTEKGLRVICG 51

  Fly    69 GSLIGSTWVLTAAHCTDGVQSVTVYLGA-TVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIK 132
            |.||...:|||||||..  :.:||.||| .||........:.....|||..:||....:||.|:|
  Rat    52 GFLISRQFVLTAAHCKG--REITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLK 114

  Fly   133 I-------PATSSSSRISAVKLPSISNSYSTFV--GDVAVASGWGRTS--DTSSGVATNLQYVDL 186
            :       ||      ::.|.|||.|:    |:  |.:..|:|||:|.  |.:|   ..|:.|:|
  Rat   115 LEKKVELTPA------VNVVPLPSPSD----FIHPGAMCWAAGWGKTGVRDPTS---YTLREVEL 166

  Fly   187 TVITNTKCAQ----TYGTSVVTDSTLCVAT-TDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAG 246
            .::....|..    .|...|      ||.: |..::...|||||||:....:.  |:.|:|..  
  Rat   167 RIMDEKACVDYRYYEYKFQV------CVGSPTTLRAAFMGDSGGPLLCAGVAH--GIVSYGHP-- 221

  Fly   247 CEKGYPAAFTRVTSYLDWIKT--NT 269
             :...||.||||::|:.||..  ||
  Rat   222 -DAKPPAIFTRVSTYVPWINAVINT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 76/244 (31%)
Tryp_SPc 38..268 CDD:238113 78/248 (31%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 76/244 (31%)
Tryp_SPc 21..242 CDD:238113 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.