DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG33461

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:296 Identity:70/296 - (23%)
Similarity:117/296 - (39%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCG 68
            |.:|.:..::|.|.|       ....||..:..:|..|:.|.:|::|:...|......|    |.
  Fly    15 LFVLGVHGSSSVFLE-------ENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFL----CA 68

  Fly    69 GSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS---------AEITHTVSSSDIIIHSGWNSANL 124
            ||||...:|||:|||.:....:...||...|.:         .|.|...:...:..|..::..:.
  Fly    69 GSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDF 133

  Fly   125 RNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAV-----------------ASGWGRTS- 171
            .|||.::::     ..|:          .|:..:..:.:                 |:|||.|| 
  Fly   134 SNDIGMLRL-----ERRV----------EYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTST 183

  Fly   172 DTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGP---LVLKSSS 233
            |.::..:..|..::|.......||:.:..:.:: ..:|....|. :.|.||||||   .||....
  Fly   184 DLNTKSSRVLMELNLYRRPRNDCARIFKQNFLS-GQICAGNDDG-NLCRGDSGGPQGRYVLIFGM 246

  Fly   234 E---QIGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266
            :   |:|:.|| ....|.|  .:..|.|..|..|||
  Fly   247 KRFVQMGIASF-TYENCSK--VSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 60/260 (23%)
Tryp_SPc 38..268 CDD:238113 63/262 (24%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/260 (23%)
Tryp_SPc 42..281 CDD:238113 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.