DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Tpsg1

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:255 Identity:86/255 - (33%)
Similarity:125/255 - (49%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVVGDIGGRITGGSNAAVGQFPYQVGLSL-KLSALSSAWCGGSLIGSTWVLTAAHCTDG-VQS-- 89
            |.|.:.|.||.||..|..|.:|:|..|.| |:..     |||||:...||||||||..| |.|  
Mouse    78 PQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHV-----CGGSLLSPEWVLTAAHCFSGSVNSSD 137

  Fly    90 VTVYLGATVRTSAEITHTVSS-----SDIIIHSGW-NSANLRNDISLIKIPA-TSSSSRISAVKL 147
            ..|:||       |:|.|:|.     ..||:::|. .......||:|:::.: .:.||::..|.|
Mouse   138 YQVHLG-------ELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCL 195

  Fly   148 PSISNSYSTFVGDVAVASGWGRTSDTSS-GVATNLQYVDLTVITNTKCAQTYGT---SVVTDSTL 208
            |..|..:  :.|.....:|||.|.:... ....|||...::|:....|:|.|.:   |::....|
Mouse   196 PEASADF--YPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDML 258

  Fly   209 CV-ATTDAKSTCNGDSGGPLVLKSSS--EQIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            |. ...||   |..|||||||.:.:.  :|.|:.|:|...| ....|..:.|||:|::||
Mouse   259 CARGPGDA---CQDDSGGPLVCQVAGTWQQAGVVSWGEGCG-RPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 81/245 (33%)
Tryp_SPc 38..268 CDD:238113 82/246 (33%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.