DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG30323

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:299 Identity:56/299 - (18%)
Similarity:90/299 - (30%) Gaps:133/299 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65
            |:||::|.|  .:||:.....:...|.:.|..:.                :|..:|::.......
  Fly     1 MQFLLLLLL--TSSAYSNEGKKGLQRNLYVTDNY----------------HQNVVSIRTRKHIRH 47

  Fly    66 W-----CGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLR 125
            |     |.|||:.:.||:|:..|              |.|..|.|....|         |..|||
  Fly    48 WGDNHFCAGSLLSAWWVVTSGCC--------------VSTRPESTPNQPS---------NRKNLR 89

  Fly   126 ---------------------------------NDISLIKIPATSSSSRISAVKLPSISNSYSTF 157
                                             .:::|:|:....:..|. |:.||. ....||:
  Fly    90 VVVFTPKRLKKPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRF-AMMLPE-KELNSTW 152

  Fly   158 VGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDS---------------- 206
            :.:   :.||||           :.||....|:    |.....|:|.|:                
  Fly   153 LCN---SLGWGR-----------IYYVSYVYIS----AMCPAFSMVYDNPVTWFQDGPYSSELIQ 199

  Fly   207 -----------------TLCVAT-TDAKSTCNGDSGGPL 227
                             .||:.: |...:.|..|.|.||
  Fly   200 IRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 47/263 (18%)
Tryp_SPc 38..268 CDD:238113 47/262 (18%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 45/237 (19%)
Tryp_SPc 45..272 CDD:214473 45/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.