DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG30187

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:275 Identity:81/275 - (29%)
Similarity:121/275 - (44%) Gaps:85/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW-----------CGGSLIGSTWVLTAAHC--T 84
            :|..:||||.|||     :|          :|.|           |||:||...:|||||||  .
  Fly    31 NIALKITGGHNAA-----FQ----------NSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVD 80

  Fly    85 DGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWN-SANLRNDISLIKIPATSSSSRISAVKLP 148
            ..||||:  |||..::.......|.::  ::||.:: .|:..|||.|:|:   ||....:|:..|
  Fly    81 QDVQSVS--LGAYNKSDPADRKDVITA--VVHSSFDVRASYENDIGLLKL---SSDVIFNALIRP 138

  Fly   149 -------SISN---SYSTFVGDVAVASGWG-----RTSDTSSGVATNLQ-----YVDLTVITNTK 193
                   |::|   :..||     .|.|||     :|||....:..|..     |::|:|..:.|
  Fly   139 ICIVLNKSMANHMRNMRTF-----KAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEK 198

  Fly   194 CAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLV-------LKSSSEQIGLTSFGASAGCEKGY 251
                         .:| |...:..||.|||||||.       :.:...|.|:.|.|.::...:| 
  Fly   199 -------------QIC-AGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQG- 248

  Fly   252 PAAFTRVTSYLDWIK 266
              .:|.:.|:.||||
  Fly   249 --VYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/268 (29%)
Tryp_SPc 38..268 CDD:238113 80/270 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 77/268 (29%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.