DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG30090

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:263 Identity:79/263 - (30%)
Similarity:121/263 - (46%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGGRITGGSNAAVGQFPYQ--VGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGA 96
            |..:|.||.:|.:...|:.  :..|:||.      |||:||...:|||||||.:...:|.|.||.
  Fly    36 IAFKIIGGRDAIINSNPWMAYIHSSVKLI------CGGTLITQRFVLTAAHCVNEGSAVKVRLGE 94

  Fly    97 TVRTSAEITHT------VSSSDIII---HSGWNSANLRNDISLIKIPA-TSSSSRISAVKLPSIS 151
            ...|:.|..::      ....|:.:   |..::.....|||:|:::.. .:..:.||.:.: .:.
  Fly    95 YDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICI-ILG 158

  Fly   152 NSYSTFVGDVA--VASGWGRT-SDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATT 213
            .|....|..:.  ||:|||.| :..:.||   ||...|....:::|.|..| .:|..:.:|....
  Fly   159 TSKRELVDSIEWFVATGWGETRTHRTRGV---LQITQLQRYNSSQCMQALG-RLVQQNQICAGRL 219

  Fly   214 DAKSTCNGDSGGPL------VLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIKT----N 268
             ...||||||||||      :.|....|.|:.|:|:.   |......:|.|.||.|||.|    |
  Fly   220 -GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSR---ECSGIGVYTDVYSYADWIATVVQQN 280

  Fly   269 TGI 271
            |.:
  Fly   281 THV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 73/248 (29%)
Tryp_SPc 38..268 CDD:238113 76/254 (30%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 73/248 (29%)
Tryp_SPc 40..276 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.