DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG30082

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:115/264 - (43%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS 101
            ||.||..|.:|..|:...|...    ||..|.|:||...:|||||||......:||.|| ...||
  Fly    39 RIVGGRTADIGSNPWLAYLHKN----SSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLG-EYDTS 98

  Fly   102 AEITHT----------VSSSDIIIHSGWNS-ANLRNDISLIKIPATSSSSRISAVKLPSISNSYS 155
            ..|..|          .|..:..||:.:.. .:.||||.|:|:..|.               .|.
  Fly    99 TRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTV---------------VYK 148

  Fly   156 TFVGDVAV--------------ASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDS 206
            .|:..:.:              |:|||:....::  ||.||.|:|..:..:.|.::..|| ::..
  Fly   149 LFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINT--ATVLQTVNLIRLDQSDCERSLRTS-LSYG 210

  Fly   207 TLCVATTDAKSTCNGDSGGPLVLKSS------SEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            ..|.....| .||:|||||||..|.|      :.|:|:.|:|... | :| |..:|.|.|:.:||
  Fly   211 QFCAGQWRA-DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYL-C-RG-PGVYTYVPSFTNWI 271

  Fly   266 KTNT 269
            .:.|
  Fly   272 LSIT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 77/258 (30%)
Tryp_SPc 38..268 CDD:238113 78/260 (30%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 77/258 (30%)
Tryp_SPc 40..274 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.