DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Cela1

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:289 Identity:81/289 - (28%)
Similarity:137/289 - (47%) Gaps:55/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSA 65
            ::||:..:|.:..         |.:::.|   :...|:.||:.|....:|.|:.|.. ||  ..:
  Rat     2 LRFLVFASLVLYG---------HSTQDFP---ETNARVVGGAEARRNSWPSQISLQY-LS--GGS 51

  Fly    66 W---CGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSD----------IIIHS 117
            |   |||:||...||:|||||.....:..|.:|         .|.:|.:|          |::|.
  Rat    52 WYHTCGGTLIRRNWVMTAAHCVSSQMTFRVVVG---------DHNLSQNDGTEQYVSVQKIVVHP 107

  Fly   118 GWNSANLR--NDISLIKI-PATSSSSRISAVKLPS----ISNSYSTFVGDVAVASGWGRTSDTSS 175
            .|||.|:.  .||:|::: .:.:.::.:....||.    ::|:...::      :|||||. |:.
  Rat   108 NWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVLPQEGTILANNNPCYI------TGWGRTR-TNG 165

  Fly   176 GVATNLQYVDLTVITNTKC-AQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL--VLKSSSEQIG 237
            .::..||...|..:..:.| :.:|..|.|..:.:|......:|.|.|||||||  ::.......|
  Rat   166 QLSQTLQQAYLPSVDYSICSSSSYWGSTVKTTMVCAGGDGVRSGCQGDSGGPLHCLVNGQYSVHG 230

  Fly   238 LTSFGASAGCE-KGYPAAFTRVTSYLDWI 265
            :|||.:|.||. ...|..||||::|:.|:
  Rat   231 VTSFVSSMGCNVSRKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 75/251 (30%)
Tryp_SPc 38..268 CDD:238113 75/252 (30%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 75/250 (30%)
Tryp_SPc 27..262 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.