DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and TPSD1

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:254 Identity:78/254 - (30%)
Similarity:114/254 - (44%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILALAVAAS-AFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSS 64
            |..|::|||.|.|| |:..|......::..:|        ||..|...::|:||.|.::    ..
Human     8 MLSLLLLALPVLASPAYVAPAPGQALQQTGIV--------GGQEAPRSKWPWQVSLRVR----GP 60

  Fly    65 AW---CGGSLIGSTWVLTAAHCTD-GVQSVTVYLGATVRTSAEITH------TVSSSDIIIHSGW 119
            .|   ||||||...||||||||.: .::.:     |.:|......|      .:..|.||:|..:
Human    61 YWMHFCGGSLIHPQWVLTAAHCVEPDIKDL-----AALRVQLREQHLYYQDQLLPVSRIIVHPQF 120

  Fly   120 NSANLRNDISLIKI-PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGV----AT 179
            .......||:|::: ...:.||.|..|.||..|.::..  |.....:|||   |..:.|    ..
Human   121 YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPP--GMPCWVTGWG---DVDNNVHLPPPY 180

  Fly   180 NLQYVDLTVITNTKCAQTYGT--------SVVTDSTLCVATTDAKSTCNGDSGGPLVLK 230
            .|:.|::.|:.|..|...|.|        .:|.|..|| |.::...:|.||||||||.|
Human   181 PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLC-AGSENHDSCQGDSGGPLVCK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 67/217 (31%)
Tryp_SPc 38..268 CDD:238113 67/216 (31%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 68/224 (30%)
Tryp_SPc 38..240 CDD:214473 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.