DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Prss8

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:247 Identity:76/247 - (30%)
Similarity:115/247 - (46%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVY---LGATV 98
            |||||.:|..||:|:||.::..    ....|||||:.:.||::||||.....|...|   |||..
  Rat    44 RITGGGSAKPGQWPWQVSITYN----GVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQ 104

  Fly    99 RTSAE---ITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSR-ISAVKLPSISNSYSTFVG 159
            ..|..   :.|||  :.||.||.:.....:.||:||::.:..:.|| |..:.||:.:.|:..  |
  Rat   105 LDSFSNDIVVHTV--AQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPN--G 165

  Fly   160 DVAVASGWGRTS-DTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTD-------STLCVA-TTDA 215
            .....:|||..: ..|......||.:::.:|:...|:..|..:.|.:       ..||.. ....
  Rat   166 LHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGG 230

  Fly   216 KSTCNGDSGGPL--VLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            |..|.|||||||  .:.......|:.|:|.:.|. ...|..:|..::|..||
  Rat   231 KDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGA-PNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 74/245 (30%)
Tryp_SPc 38..268 CDD:238113 75/246 (30%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 74/245 (30%)
Tryp_SPc 45..284 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.