DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and try-5

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:238 Identity:63/238 - (26%)
Similarity:95/238 - (39%) Gaps:77/238 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSLIGSTWVLTAAHC--------TDGVQSVTV---YLGATVR-TSAEI-THTVSSSDII---- 114
            |||:||....|||||||        .:|.:..::   |..:..| |.:|| |.||.:...:    
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRL 137

  Fly   115 ------IHSGWNSANLR-----------------NDISLIKIPATSSSSRISAVK------LPSI 150
                  ::...|...|:                 |||.::::.:|     |..|:      ||  
 Worm   138 EQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELEST-----IDDVEGANYACLP-- 195

  Fly   151 SNSYSTFVGDVAVAS-------GWGRTSDTSSG----VATNLQYVDLTVITNTKCAQTYGTSVVT 204
                  |:.:|.:.|       |||  ||...|    ....:|.:.|...|...|.:.:|||:..
 Worm   196 ------FLPEVNIQSGANVTSFGWG--SDPGKGFDNAAFPMIQVLTLATETLATCEENWGTSIPF 252

  Fly   205 DSTLCVATTDAKSTCNGDSGGPLVLKSSSEQ----IGLTSFGA 243
            || .|.|..:.|:.|:|||||.|....|...    |.:.|:|:
 Worm   253 DS-FCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 63/238 (26%)
Tryp_SPc 38..268 CDD:238113 63/238 (26%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.