DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and try-4

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:287 Identity:68/287 - (23%)
Similarity:114/287 - (39%) Gaps:80/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VGQFPYQVGLSLK-LSALSSAWCGGSLIGSTWVLTAAH------------CTDG---------VQ 88
            :..||:.|..::. ::.|     |||:|....::||||            |.:.         .:
 Worm    55 IKNFPWAVSFTVDGVNRL-----GGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYR 114

  Fly    89 SV--------TVYLGATVRTSAEITHT--------VSSSDII--------IHSGWNSANL--RND 127
            |:        ..|.|..:|     .||        ...||:|        :...:.|:|.  .:|
 Worm   115 SIKFLRDTRKVAYGGTCIR-----GHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHD 174

  Fly   128 ISLIKI-PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRT-SDTSSGVATNLQYVDLTVIT 190
            .::::: .....|..:..:.||. .|.|  :...:|| .||||: ....||...:    ::.:..
 Worm   175 WAIVEVEKRIHFSENVRPICLPR-PNMY--YTKSLAV-PGWGRSYIFNESGPLIH----EIPMRI 231

  Fly   191 NTKCAQTYGTSVVTDST--LC-----VATTDAKSTCNGDSGGPLVLKSSSE----QIGLTSFGAS 244
            :..|.:.:...:..|:.  :|     |:...|..||:|||||.|..:..:.    .|.:|||| :
 Worm   232 DRDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFG-T 295

  Fly   245 AGCEKGYPAAFTRVTSYLDWIKTNTGI 271
            .||.....|.||||..||:.|...||:
 Worm   296 RGCPSNMLARFTRVDMYLNLICNYTGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/279 (23%)
Tryp_SPc 38..268 CDD:238113 66/282 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 66/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.