DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CTRL

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:233 Identity:93/233 - (39%)
Similarity:130/233 - (55%) Gaps:12/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS 101
            ||..|.||.:|.:|:||.|.   .:....:||||||..:||:|||||........|.||...|:|
Human    33 RIVNGENAVLGSWPWQVSLQ---DSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSS 94

  Fly   102 -AEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSS-SSRISAVKLPSISNSYSTFVGDVAVA 164
             ||....:|.|..|.|..|||..:.||::|:|:.:.:. ::|||.|.|.| ||...| .|...|.
Human    95 NAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLAS-SNEALT-EGLTCVT 157

  Fly   165 SGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVL 229
            :||||.|...:....:||.|.|.::|..:|.|.:|:| :|||.:|.....| |:|.||||||||.
Human   158 TGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSS-ITDSMICAGGAGA-SSCQGDSGGPLVC 220

  Fly   230 KSSSE--QIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            :..:.  .||:.|:| :..|....||.:|||:.:..||
Human   221 QKGNTWVLIGIVSWG-TKNCNVRAPAVYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 91/231 (39%)
Tryp_SPc 38..268 CDD:238113 92/232 (40%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 92/232 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.