DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG43336

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:116/265 - (43%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTD 85
            :|..|..:|       |:..|:.|::...|:...|.   |......||||||.:..|||||||..
  Fly    28 IRAHSPSVP-------RVKNGTVASLTSSPWMAFLH---STDGRFICGGSLITNRLVLTAAHCFL 82

  Fly    86 GVQSVTVYLGATVRTSAEITH----TVSSSDII----IHSGWNSANLRNDISLI----KIPATSS 138
            ....:...||...|...|:.|    |.....::    .|..:|...:..||:::    |:..|.:
  Fly    83 DRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDN 147

  Fly   139 SSRISAVKLPSISNSYSTFVG--DVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTS 201
            ...|..|    |...:..::.  |....:|||:|.  |.|.:..|:.||| ...:.:..:.|.|.
  Fly   148 IRPICIV----IDPRWRKYIDSLDPLTGTGWGKTE--SEGDSAKLRTVDL-ARKHPEVCRRYATL 205

  Fly   202 VVTDSTLCVATTDAKSTCNGDSGGP---LVLKSSSE---QIGLTSFGASAGCEKGYPAAFTRVTS 260
            .:|.:..| |..:..:.||||||||   |:....|:   |:|:.|| .:..|.  ..:.||.|.|
  Fly   206 SLTANQFC-AGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASF-TNTQCV--MVSVFTDVMS 266

  Fly   261 YLDWI 265
            |:|||
  Fly   267 YVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 71/247 (29%)
Tryp_SPc 38..268 CDD:238113 72/248 (29%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 71/247 (29%)
Tryp_SPc 40..271 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.