DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Ctrl

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:238 Identity:86/238 - (36%)
Similarity:127/238 - (53%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVT-----VYLGA 96
            ||..|.||..|.:|:||.|.   ......:||||||...||:|||||     .||     |.||.
Mouse    33 RIVNGENAVPGSWPWQVSLQ---DNTGFHFCGGSLISPNWVVTAAHC-----QVTPGRHFVVLGE 89

  Fly    97 TVRTS-AEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSS-SSRISAVKLPSISNSYSTFVG 159
            ..|:| ||....:|.:..|.|..||:..:.||::|:|:.:.:. ::::|.|.|.|.:.:..:  |
Mouse    90 YDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCLASTNEALPS--G 152

  Fly   160 DVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSG 224
            ...|.:||||.|...:.....||.|.|.::|..:|.|.:|.. :||:.:|...:.| |:|.||||
Mouse   153 LTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGAR-ITDAMICAGGSGA-SSCQGDSG 215

  Fly   225 GPLVLKSSSE--QIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            ||||.:..:.  .||:.|:| :..|....||.:|||:.:..||
Mouse   216 GPLVCQKGNTWVLIGIVSWG-TKNCNIQAPAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 84/236 (36%)
Tryp_SPc 38..268 CDD:238113 85/237 (36%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 84/236 (36%)
Tryp_SPc 34..260 CDD:238113 85/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.