DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG42694

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:238 Identity:64/238 - (26%)
Similarity:98/238 - (41%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIH 116
            |.|....:|..:...|.||||...:||:||.|.|....:.|.||.:..|.:...:|||:..|..|
  Fly    43 QAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSH 107

  Fly   117 SGWNSANLRNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSD--------- 172
            ||   ..|:.||.|:|:               |.|..|:.||..:.:|.. ..|.|         
  Fly   108 SG---KRLQRDIGLLKL---------------SQSVDYNDFVYPICIALN-TNTLDMVKILQNFT 153

  Fly   173 TSSGVATNL--QYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLV--LKSSS 233
            ||:.::.|.  |.:.|:.::..:|......: ||...:|.|:....::|..|||..|.  :...|
  Fly   154 TSAWLSKNKNPQTIVLSQLSRDRCKLNLSGN-VTPKEICAASLQRNNSCFIDSGSALTQPIIQGS 217

  Fly   234 EQIGLTSFGASAGCEKGY---------PAAFTRVTSYLDWIKT 267
            ..:....||.     :||         ||.:..|...:.||:|
  Fly   218 NIVREMLFGI-----RGYVNGRSWCSEPAIYIDVAECVGWIET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 61/234 (26%)
Tryp_SPc 38..268 CDD:238113 64/238 (27%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 62/235 (26%)
Tryp_SPc 46..253 CDD:214473 59/231 (26%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.